PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn041581
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ZF-HD
Protein Properties Length: 233aa    MW: 25951.7 Da    PI: 7.4388
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn041581genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.99.1e-3248104360
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                  +vrY+eC+kNhA+s+GghavDGCgEfmp+ g++gt ++l CaAC+CHR+FHR+e+e e
   Achn041581  48 QVRYRECKKNHAVSIGGHAVDGCGEFMPA-GDDGTLNTLICAACNCHRSFHRKEEEGE 104
                  79**************************9.999*********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.1E-2948101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-2050106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.7E-2950100IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.76851100IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.7E-33157231IPR009057Homeodomain-like
SuperFamilySSF466894.62E-21159230IPR009057Homeodomain-like
TIGRFAMsTIGR015653.1E-26169225IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MEFDEHEEQE EETGIQVQAN YDTAVAGNSG RPKMGGGGEA AALRRGGQVR YRECKKNHAV  60
SIGGHAVDGC GEFMPAGDDG TLNTLICAAC NCHRSFHRKE EEGEAFHRHH HHHQQQQQQL  120
SPYYRTANPA GYLHVAPPPH QRPLALPSAE REEEDMSNPS SSGGGSGSKK RFRTKFTQDQ  180
KDKMLEFAER LGWRIQKQDE AAVEQFCAET GVKRNVLKVW MHNNKHTLGK KP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-281682271675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010266504.12e-99PREDICTED: zinc-finger homeodomain protein 1-like
SwissprotQ9SB612e-74ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLA0A0D2V5799e-95A0A0D2V579_G
STRINGVIT_18s0001g07140.t013e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.14e-68homeobox protein 22